GrowthPublished June 17, 2026

Most Schools Have Two Phone Systems. Only One Is Visible.

Drew Jones
Drew Jones
Head of Marketing
The phone call still closes enrollments. It just migrated to a device the school doesn't own, can't audit, and can't legally produce a record of. The financial services world learned this lesson the hard way starting in 2021. Career schools are about to.

The phone didn't die. It migrated.

Most career schools have heard the same argument the last two years. Phones are dead. The data backs the conclusion at the surface. Cold call success sat at 4.82% in 2024, dropped to 2.3% in 2025, and recovered to 2.7% in 2026. iOS 26 added a call-screening layer that silently answers unknown calls, asks the caller to state their name and reason, and only rings the iPhone if the response is satisfactory. Android does parallel screening. The reasonable conclusion is that the phone call is over in admissions.

That conclusion is wrong.

The same phone, two positions. One is dying. The other is working.

Cold call · unknown numberCall after a text (sequenced)0%4%8%12%Late 2025iOS 26 call screening rolls out10.8%after a text · ≈4×2.7%cold · unknown #2023202420252026
Cold-call connect rate from an unknown number versus pickup rate on a call placed after a text, 2023–2026. Source: Cognism State of Cold Calling 2025–2026; Apten call connect rate data; Apple iOS 26 documentation.Lumion

The data tells two different stories. Cold calls from unknown numbers are broken. The phone call at career schools that actually produces enrollments is alive. It just moved. The phone shifted from prospecting to closing, and the calls that work are scheduled, expected, and dialed from a number the student recognizes.

That much is widely discussed. There's a more important story underneath it. The phone calls that actually do enroll students at career schools increasingly happen on a device the school doesn't own, can't audit, and can't legally produce a record of.

That migration is what this article is about.

The system you bought isn't the system you're running

Most career schools have two phone systems.

The official one is the line on the website, routed through the front desk, maybe with VOIP layered on top. It handles inbound calls during business hours, voicemail messages, and the occasional outbound call placed from a rep's desk.

The unofficial one is a half-dozen personal cell phones used by admissions reps for the conversations that actually matter. Late-evening callbacks. Saturday morning conversations with prospects who only have time on weekends. Every text exchange. Every "let me follow up with you." And most of the calls that move the enrollment forward.

The school sees the first system, pays for the first system, and tracks the first system in compliance audits and operations reports. The actual work of enrolling students happens on the second one.

That arrangement is invisible until something goes wrong. The conditions that would make it go wrong are now in place.

What the financial services world already learned the hard way

The structural problem in front of career schools has an exact analog, and it's been on the regulatory enforcement docket for five years.

Since December 2021, the SEC and FINRA have fined more than 100 financial firms over $2.2 billion for "off-channel communications," meaning employees doing business on personal phones outside the firm's archived systems. Penalties per firm have run from $4M to $12M. The January 2025 enforcement action alone targeted 12 firms.

$2.2 billion

in SEC / FINRA fines for off-channel communications across more than 100 financial firms since December 2021.

Can you produce the record?

The same regulatory question is coming for career schools — from different regulators.

SEC and FINRA off-channel communications enforcement, December 2021 to present. Source: cumulative fines via IQ-EQ U.S., COMMACOMPLIANCE, and SEC enforcement releases.Lumion

The regulatory question in every case was identical. Can you produce the record? Without an archived institutional record, the firm couldn't defend itself. Penalties were sized to the scale of business done on those personal channels.

Career schools don't face FINRA. They face DOE program reviews, state AG investigations, TCPA litigation, and Title IV program integrity audits. The structural failure is identical: a question is asked about what was said on the call, and the institution can't produce the record because the call happened on a personal device the institution doesn't own. The regulator is different. The defenselessness is the same.

What it costs when a rep leaves

The cleanest data on admissions turnover comes from CUPA-HR's Higher Education Admissions Workforce report, covering more than 12,000 employees across 940 institutions. 71% of admissions reps have held their position for three years or less. Average tenure is two years. The median age of admissions staff is 30. 76% of the workforce is under 40.

Every personal cell is a 24-month timer on the conversations a school can't keep.

Still at the schoolHas left — calls gone with themDAY 110 reps0 conversations goneMONTH 245 repsCalls from 5 personal cells goneMONTH 363 repsCalls from 7 personal cells gone
A 10-rep admissions cohort modeled to CUPA-HR's 2-year average tenure — half gone by month 24, ~70% by month 36. Source: CUPA-HR Higher Education Admissions Workforce Report (n=12,000+ across 940 institutions).Lumion

SHRM's research puts direct replacement costs at 50% to 60% of annual salary, with total costs running 90% to 200% once ramp time and productivity loss are included. For an admissions rep at $60K, that's a $30K to $120K cost per departure before any pipeline disruption.

Now layer in the in-flight pipeline. When the rep using a personal cell phone leaves the school, every conversation they had walks out the door with them. The CRM has no call log. The new rep inherits a list of names with no objection history, no next-step notes, no relationship signal. They start cold on warm leads. The school just paid $30K to $120K to replace the person, and the pipeline starts at zero.

There's no peer-reviewed dollar figure for the in-flight pipeline loss specifically. But the mechanism is concrete and the math is uncomfortable. Speed-to-lead research from Rework says responding within 5 minutes makes a school 100 times more likely to connect than waiting 30 minutes. The departed rep's untouched pipeline ages out of the warm window entirely while the school searches for a replacement.

The TCPA exposure nobody's tracking

The TCPA picture for voice calls got more complicated in 2025-2026, not less. Two circuit-court rulings created a split that's still working through the system.

The Eleventh Circuit vacated the FCC's one-to-one consent rule on January 24, 2025. The rule had been set to take effect three days later. The Fifth Circuit went further on February 25, 2026, holding that the TCPA does not require written consent for telemarketing calls, only some form of prior express consent.

Franklin v. DePaul University

N.D. Ill. · 2017

A federal court found DePaul's consent records insufficient even though they showed an opt-in. The student claimed he never consented, and DePaul couldn't produce documentation that the consent disclosure was clear and conspicuous.

Producing the record matters more than checking the box.

Source: Thompson Coburn TCPA compliance briefing prepared for CAPPS career-school operators, October 2024.Lumion

The practical question for a career school making voice calls in 2026 is unchanged. Can you produce documented consent for every call you placed, and did you honor every revocation? A personal cell call leaves you defenseless on both questions.

A rep dialing from a personal cell phone creates three specific TCPA exposures most schools aren't tracking:

Consent recordkeeping failure. The FTC's updated Telemarketing Sales Rule, effective October 2024, requires that consent records, call detail records, scripts, and DNC lists be retained for five years. A call made from a personal cell creates zero call detail records at the institutional level. When the student claims they never consented, there's nothing to produce.

DNC cross-contamination. The rep has no real-time access to the institutional DNC list. If they call a number that's on the National DNC Registry or the school's internal opt-out list, the school is liable for a violation it had no mechanism to prevent.

Consent revocation tracking. Consumers can revoke consent "in any reasonable manner" since April 2025, including by verbally telling a live caller to stop calling. The school has 10 business days to honor the revocation across all channels. If the rep doesn't log it to the CRM and leaves the school the following week, the revocation is functionally lost. The school stays exposed.

TCPA class action filings were up 112% in 2025. The top 10 settlements totaled $84.73 million in 2024.

Recording, the state map

11 states require all-party consent for call recording: California, Delaware, Florida, Illinois, Maryland, Massachusetts, Montana, Nevada, New Hampshire, Pennsylvania, and Washington. The remaining 39 require only one-party consent.

When parties are in different states, the stricter law applies.

All-party (two-party) consent · 11 statesOne-party consent · 39 states + DCAKMEVTNHWAIDMTNDMNILWIMINYMAORNVWYSDIAINOHPANJCTRICAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCHITXOKLAMSALGAFLUtah → CaliforniaCalifornia's rule governs.Two-party consent required.Pennsylvania → New YorkPennsylvania's rule governs.Two-party consent required.Texas → TexasTexas rule governs.One-party consent.
All-party (two-party) consent states in coral; one-party in gray. The school placing the call carries the obligation. Source: state call recording statutes; federal 18 U.S.C. § 2511; practitioner summaries from Rev and Kixie.Lumion

For a rep making calls from a personal cell, the recording picture is broken three different ways.

The school has no institutional recording. No QA capability, no training data, no compliance evidence if a dispute arises. The rep may be recording to their personal device, which in two-party states creates liability for the school if the student wasn't notified. Or the rep isn't recording at all, which means that if a student later claims the rep misrepresented program outcomes, tuition terms, or financial aid, the school has no counter-evidence.

Misrepresentation in admissions calls is a documented basis for FTC and state AG enforcement against career schools. Program integrity audits under Title IV scrutinize admissions practices. The absence of call recordings doesn't help the school in any of those contexts. It only hurts.

The phone re-sequenced

Cold calling from an unknown number sits at 2.7% in 2026. A call from a recognized number, expected, scheduled, and warmed up by a text, still closes enrollments. The same phone in two different positions in the funnel does two completely different things.

The phone didn't die. It migrated down the funnel.

Cold call · unknown numberSequenced call · after a text2.7%low2.0%≈4×WHERE THE PHONE WORKS TODAY↓ highestlowInquiryApplication startedAdmitted, not registered
Cold call from an unknown number versus a sequenced call after a text, by funnel stage. Source: Cognism 2025–2026; Apten; UWM Recruiting the Silent Funnel (2025); Dan Tudor admissions guidance.Lumion

The University of Wisconsin-Milwaukee's Recruiting the Silent Funnel research identifies two specific call moments that move the needle for enrollment. Admitted-but-unregistered conversion calls. Stalled-application-restart calls. Both are deep in the funnel. The student already knows the school. The call is expected.

Dan Tudor's admissions guidance is direct: "Most students don't answer the phone because admissions counselors cold call at random times. Particularly with your admitted students, set up your calls via a short text message or email."

Nancy Rogers, an admissions operations practitioner, reports client results from text-first sequencing: "In the last few months, we have asked our clients to text before calling and they have seen a nice uptick in the connection percentage." The sequence she recommends starts with a text identifying the rep, then the call follows within minutes.

Apten reports a 4x increase in call pickup rates when a text precedes the call. The vendor data should be qualified, but the direction is consistent with the practitioner reports.

The phone didn't die. It got re-sequenced into the closing slot. The cold call from an unknown personal cell at 11 AM on a Tuesday became the lowest-yield activity in modern admissions.

Five operator moves

  1. Audit your shadow phone system this week. Ask every admissions rep how many calls they made on a personal cell last month. The answer will be the first real measure of the gap.
  2. Stop letting reps use personal cells for student communication. Give every rep a school-owned number that follows them across devices. The conversations live at the institution.
  3. Record every call with proper consent. State-compliant disclosure handled by the platform. Every call becomes auditable, QA-able, and trainable for new reps.
  4. Move the phone to the closing slot. Stop using cold calls as first touch. Text first, identify yourself, then call. The phone is the conversion instrument, not the prospecting instrument.
  5. Build the consent and revocation infrastructure. Every consent recorded with timestamp, every revocation logged within 10 business days, every state-by-state recording rule handled automatically. The infrastructure exists. The exposure is documented.

The phone didn't die. It just moved.

The phone call still closes enrollments. Just not from a personal cell at 11 AM on a Tuesday.

The schools that run admissions on their own phone system, rather than a dozen personal phones their reps happen to own, get to keep the conversations when the reps leave, can answer the regulator when the question comes, and put the phone call back where the data says it actually works. In the closing slot.

The question is whether your school moved with it.

Read next

Newsletter

The State of Trade

Field notes and real-world insight for the schools that make the world go 'round. Twice a month, straight to your inbox.

No spam. Unsubscribe anytime.